Lineage for d2ny4c2 (2ny4 C:2112-2214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516277Domain d2ny4c2: 2ny4 C:2112-2214 [138785]
    Other proteins in same PDB: d2ny4a1, d2ny4b1, d2ny4b2, d2ny4c1, d2ny4d1, d2ny4d2
    automated match to d1rz8a2
    complexed with hez, nag, suc

Details for d2ny4c2

PDB Entry: 2ny4 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e268c, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2ny4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny4c2 b.1.1.2 (C:2112-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d2ny4c2:

Click to download the PDB-style file with coordinates for d2ny4c2.
(The format of our PDB-style files is described here.)

Timeline for d2ny4c2: