Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries) SQ NA # humanized antibody Uniprot P01834 # KAC_HUMAN Ig kappa chain C region SQ P01834 # KAC_HUMAN Ig kappa chain C region. SQ NA # engineered antibody including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d2ny4c2: 2ny4 C:2110-2214 [138785] Other proteins in same PDB: d2ny4a1, d2ny4b1, d2ny4b2, d2ny4c1, d2ny4d1, d2ny4d2 automatically matched to d1g9ml2 complexed with hez, nag, suc; mutant |
PDB Entry: 2ny4 (more details), 2 Å
SCOP Domain Sequences for d2ny4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny4c2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d2ny4c2: