| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein CD4 V-set domains [48737] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) |
| Domain d2ny4b1: 2ny4 B:1001-1097 [138782] Other proteins in same PDB: d2ny4a1, d2ny4b2, d2ny4c1, d2ny4c2, d2ny4d1, d2ny4d2 complexed with hez, nag, suc |
PDB Entry: 2ny4 (more details), 2 Å
SCOPe Domain Sequences for d2ny4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny4b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d2ny4b1: