SCOP 1.73: Domain d2ny3c2: 2ny3 C:2110-2214

Lineage for d2ny3c2 (2ny3 C:2110-2214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2ny3c2: 2ny3 C:2110-2214 [138779]
   Other proteins in same PDB: d2ny3b1, d2ny3b2, d2ny3c1, d2ny3d1, d2ny3d2
   automatically matched to d1g9ml2
   complexed with nag, suc; mutant

Details for d2ny3c2

PDB Entry: 2ny3, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e267c, s334a, s375w) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2ny3c2:

Sequence; same for both SEQRES and ATOM records:

>d2ny3c2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d2ny3c2:

• d2ny3c2 is new in SCOP 1.73
  
• d2ny3c2 appears in SCOP 1.75
  
• d2ny3c2 appears in the current release, SCOPe 2.08