![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries) |
![]() | Domain d2ny3b2: 2ny3 B:1098-1181 [138777] Other proteins in same PDB: d2ny3a1, d2ny3b1, d2ny3c1, d2ny3c2, d2ny3d1, d2ny3d2 automatically matched to d1g9mc2 complexed with nag, suc; mutant |
PDB Entry: 2ny3 (more details), 2 Å
SCOP Domain Sequences for d2ny3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny3b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d2ny3b2: