Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (36 PDB entries) |
Domain d2ny2d1: 2ny2 D:3001-3128 [138774] Other proteins in same PDB: d2ny2a1, d2ny2b1, d2ny2b2, d2ny2c1, d2ny2c2, d2ny2d2 automatically matched to d1rz8b1 complexed with edo, hez, nag, suc |
PDB Entry: 2ny2 (more details), 2 Å
SCOPe Domain Sequences for d2ny2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny2d1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq gtlvtvss
Timeline for d2ny2d1: