Lineage for d2ny2c2 (2ny2 C:2110-2214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655961Domain d2ny2c2: 2ny2 C:2110-2214 [138773]
    Other proteins in same PDB: d2ny2b1, d2ny2b2, d2ny2c1, d2ny2d1, d2ny2d2
    automatically matched to d1g9ml2
    complexed with edo, hez, nag, suc; mutant

Details for d2ny2c2

PDB Entry: 2ny2 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2ny2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny2c2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d2ny2c2:

Click to download the PDB-style file with coordinates for d2ny2c2.
(The format of our PDB-style files is described here.)

Timeline for d2ny2c2: