Lineage for d2ny2b1 (2ny2 B:1001-1097)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652065Protein CD4 V-set domains [48737] (2 species)
  7. 652066Species Human (Homo sapiens) [TaxId:9606] [48738] (25 PDB entries)
  8. 652068Domain d2ny2b1: 2ny2 B:1001-1097 [138770]
    Other proteins in same PDB: d2ny2b2, d2ny2c1, d2ny2c2, d2ny2d1, d2ny2d2
    automatically matched to d1cdi_1
    complexed with edo, hez, nag, suc; mutant

Details for d2ny2b1

PDB Entry: 2ny2 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d2ny2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny2b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d2ny2b1:

Click to download the PDB-style file with coordinates for d2ny2b1.
(The format of our PDB-style files is described here.)

Timeline for d2ny2b1: