SCOP 1.75: Domain d2ny1c2: 2ny1 C:2110-2214

Lineage for d2ny1c2 (2ny1 C:2110-2214)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   SQ NA # humanized antibody
   Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
   SQ P01834 # KAC_HUMAN Ig kappa chain C region.
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2ny1c2: 2ny1 C:2110-2214 [138767]
   Other proteins in same PDB: d2ny1a1, d2ny1b1, d2ny1b2, d2ny1c1, d2ny1d1, d2ny1d2
   automatically matched to d1g9ml2
   complexed with nag, suc; mutant

Details for d2ny1c2

PDB Entry: 2ny1, 1.99 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2ny1c2:

Sequence; same for both SEQRES and ATOM records:

>d2ny1c2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d2ny1c2:

• d2ny1c2 first appeared in SCOP 1.73
  
• d2ny1c2 appears in SCOPe 2.01
  
• d2ny1c2 appears in the current release, SCOPe 2.08