SCOP 1.73: Domain d2ny1b2: 2ny1 B:1098-1181

Lineage for d2ny1b2 (2ny1 B:1098-1181)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (25 PDB entries)

8. Domain d2ny1b2: 2ny1 B:1098-1181 [138765]
   Other proteins in same PDB: d2ny1b1, d2ny1c1, d2ny1c2, d2ny1d1, d2ny1d2
   automatically matched to d1g9mc2
   complexed with nag, suc; mutant

Details for d2ny1b2

PDB Entry: 2ny1, 1.99 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d2ny1b2:

Sequence; same for both SEQRES and ATOM records:

>d2ny1b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

Timeline for d2ny1b2:

• d2ny1b2 is new in SCOP 1.73
  
• d2ny1b2 appears in SCOP 1.75
  
• d2ny1b2 appears in the current release, SCOPe 2.08