Lineage for d2ny1b1 (2ny1 B:1001-1097)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781640Protein CD4 V-set domains [48737] (2 species)
  7. 781641Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries)
  8. 781647Domain d2ny1b1: 2ny1 B:1001-1097 [138764]
    Other proteins in same PDB: d2ny1a1, d2ny1b2, d2ny1c1, d2ny1c2, d2ny1d1, d2ny1d2
    automatically matched to d1cdi_1
    complexed with nag, suc; mutant

Details for d2ny1b1

PDB Entry: 2ny1 (more details), 1.99 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d2ny1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny1b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d2ny1b1:

Click to download the PDB-style file with coordinates for d2ny1b1.
(The format of our PDB-style files is described here.)

Timeline for d2ny1b1: