![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein CD4 V-set domains [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries) |
![]() | Domain d2ny1b1: 2ny1 B:1001-1097 [138764] Other proteins in same PDB: d2ny1a1, d2ny1b2, d2ny1c1, d2ny1c2, d2ny1d1, d2ny1d2 automatically matched to d1cdi_1 complexed with nag, suc; mutant |
PDB Entry: 2ny1 (more details), 1.99 Å
SCOP Domain Sequences for d2ny1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny1b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d2ny1b1: