SCOPe 2.06: Domain d2ny0d2: 2ny0 D:3129-3229

Lineage for d2ny0d2 (2ny0 D:3129-3229)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2ny0d2: 2ny0 D:3129-3229 [138763]
   Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0b2, d2ny0c1, d2ny0c2, d2ny0d1
   automated match to d1rzjh2
   complexed with hez, nag

Details for d2ny0d2

PDB Entry: 2ny0, 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b

PDB Compounds: (D:) antibody 17b, heavy chain

SCOPe Domain Sequences for d2ny0d2:

Sequence, based on SEQRES records:

>d2ny0d2 b.1.1.2 (D:3129-3229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d2ny0d2 b.1.1.2 (D:3129-3229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2ny0d2:

• d2ny0d2 first appeared in SCOP 1.73
  
• d2ny0d2 appears in SCOPe 2.05
  
• d2ny0d2 appears in SCOPe 2.07
  
• d2ny0d2 appears in the current release, SCOPe 2.08