Lineage for d2ny0b2 (2ny0 B:1098-1181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364787Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2364797Protein CD4 C2-set domains [49149] (2 species)
  7. 2364798Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)
  8. 2364814Domain d2ny0b2: 2ny0 B:1098-1181 [138759]
    Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0c1, d2ny0c2, d2ny0d1, d2ny0d2
    complexed with hez, nag

Details for d2ny0b2

PDB Entry: 2ny0 (more details), 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny0b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOPe Domain Coordinates for d2ny0b2:

Click to download the PDB-style file with coordinates for d2ny0b2.
(The format of our PDB-style files is described here.)

Timeline for d2ny0b2: