Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries) |
Domain d2ny0b2: 2ny0 B:1098-1181 [138759] Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0c1, d2ny0c2, d2ny0d1, d2ny0d2 complexed with hez, nag |
PDB Entry: 2ny0 (more details), 2.2 Å
SCOPe Domain Sequences for d2ny0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny0b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d2ny0b2: