SCOP 1.75: Domain d2ny0b2: 2ny0 B:1098-1181

Lineage for d2ny0b2 (2ny0 B:1098-1181)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)

8. Domain d2ny0b2: 2ny0 B:1098-1181 [138759]
   Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0c1, d2ny0c2, d2ny0d1, d2ny0d2
   automatically matched to d1g9mc2
   complexed with hez, nag; mutant

Details for d2ny0b2

PDB Entry: 2ny0, 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d2ny0b2:

Sequence; same for both SEQRES and ATOM records:

>d2ny0b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

Timeline for d2ny0b2:

• d2ny0b2 first appeared in SCOP 1.73
  
• d2ny0b2 appears in SCOPe 2.01
  
• d2ny0b2 appears in the current release, SCOPe 2.08