Lineage for d2ny0b1 (2ny0 B:1001-1097)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103355Protein CD4 V-set domains [48737] (2 species)
  7. 1103356Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries)
  8. 1103364Domain d2ny0b1: 2ny0 B:1001-1097 [138758]
    Other proteins in same PDB: d2ny0a1, d2ny0b2, d2ny0c1, d2ny0c2, d2ny0d1, d2ny0d2
    automatically matched to d1cdi_1
    complexed with hez, nag

Details for d2ny0b1

PDB Entry: 2ny0 (more details), 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny0b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d2ny0b1:

Click to download the PDB-style file with coordinates for d2ny0b1.
(The format of our PDB-style files is described here.)

Timeline for d2ny0b1: