Lineage for d2ny0a1 (2ny0 A:83-491)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738566Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 738567Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 738568Family d.172.1.1: gp120 core [56503] (1 protein)
  6. 738569Protein gp120 core [56504] (1 species)
  7. 738570Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (10 PDB entries)
  8. 738571Domain d2ny0a1: 2ny0 A:83-491 [138757]
    Other proteins in same PDB: d2ny0b1, d2ny0b2, d2ny0c1, d2ny0c2, d2ny0d1, d2ny0d2
    complexed with hez, nag; mutant

Details for d2ny0a1

PDB Entry: 2ny0 (more details), 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (A:) envelope glycoprotein gp120

SCOP Domain Sequences for d2ny0a1:

Sequence, based on SEQRES records: (download)

>d2ny0a1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwqkvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvki

Sequence, based on observed residues (ATOM records): (download)

>d2ny0a1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstgsdtitlpcrikqiin
mwqkvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselyk
ykvvki

SCOP Domain Coordinates for d2ny0a1:

Click to download the PDB-style file with coordinates for d2ny0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ny0a1: