Lineage for d2nxzb2 (2nxz B:1098-1181)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295282Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1295292Protein CD4 C2-set domains [49149] (2 species)
  7. 1295293Species Human (Homo sapiens) [TaxId:9606] [49150] (29 PDB entries)
  8. 1295300Domain d2nxzb2: 2nxz B:1098-1181 [138752]
    Other proteins in same PDB: d2nxza1, d2nxzb1, d2nxzc1, d2nxzc2, d2nxzd1, d2nxzd2
    complexed with edo, hez, ipa, nag, suc

Details for d2nxzb2

PDB Entry: 2nxz (more details), 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2nxzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxzb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOPe Domain Coordinates for d2nxzb2:

Click to download the PDB-style file with coordinates for d2nxzb2.
(The format of our PDB-style files is described here.)

Timeline for d2nxzb2: