| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein CD4 V-set domains [48737] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48738] (29 PDB entries) |
| Domain d2nxzb1: 2nxz B:1001-1097 [138751] Other proteins in same PDB: d2nxza1, d2nxzb2, d2nxzc1, d2nxzc2, d2nxzd1, d2nxzd2 complexed with edo, hez, ipa, nag, suc |
PDB Entry: 2nxz (more details), 2.04 Å
SCOPe Domain Sequences for d2nxzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nxzb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d2nxzb1: