Lineage for d2nxzb1 (2nxz B:1001-1097)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287527Protein CD4 V-set domains [48737] (2 species)
  7. 1287528Species Human (Homo sapiens) [TaxId:9606] [48738] (29 PDB entries)
  8. 1287535Domain d2nxzb1: 2nxz B:1001-1097 [138751]
    Other proteins in same PDB: d2nxza1, d2nxzb2, d2nxzc1, d2nxzc2, d2nxzd1, d2nxzd2
    complexed with edo, hez, ipa, nag, suc

Details for d2nxzb1

PDB Entry: 2nxz (more details), 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2nxzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxzb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d2nxzb1:

Click to download the PDB-style file with coordinates for d2nxzb1.
(The format of our PDB-style files is described here.)

Timeline for d2nxzb1: