SCOP 1.73: Domain d2nxzb1: 2nxz B:1001-1097

Lineage for d2nxzb1 (2nxz B:1001-1097)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (25 PDB entries)

8. Domain d2nxzb1: 2nxz B:1001-1097 [138751]
   Other proteins in same PDB: d2nxzb2, d2nxzc1, d2nxzc2, d2nxzd1, d2nxzd2
   automatically matched to d1cdi_1
   complexed with edo, hez, ipa, nag, suc; mutant

Details for d2nxzb1

PDB Entry: 2nxz, 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d2nxzb1:

Sequence; same for both SEQRES and ATOM records:

>d2nxzb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d2nxzb1:

• d2nxzb1 is new in SCOP 1.73
  
• d2nxzb1 appears in SCOP 1.75
  
• d2nxzb1 appears in the current release, SCOPe 2.08