Lineage for d2nxyc2 (2nxy C:2110-2214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655953Domain d2nxyc2: 2nxy C:2110-2214 [138748]
    Other proteins in same PDB: d2nxyb1, d2nxyb2, d2nxyc1, d2nxyd1, d2nxyd2
    automatically matched to d1g9ml2
    complexed with hez, nag, trs; mutant

Details for d2nxyc2

PDB Entry: 2nxy (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2nxyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxyc2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d2nxyc2:

Click to download the PDB-style file with coordinates for d2nxyc2.
(The format of our PDB-style files is described here.)

Timeline for d2nxyc2: