SCOP 1.73: Domain d2nxyc2: 2nxy C:2110-2214

Lineage for d2nxyc2 (2nxy C:2110-2214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2nxyc2: 2nxy C:2110-2214 [138748]
   Other proteins in same PDB: d2nxyb1, d2nxyb2, d2nxyc1, d2nxyd1, d2nxyd2
   automatically matched to d1g9ml2
   complexed with hez, nag, trs; mutant

Details for d2nxyc2

PDB Entry: 2nxy, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2nxyc2:

Sequence; same for both SEQRES and ATOM records:

>d2nxyc2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d2nxyc2:

• d2nxyc2 is new in SCOP 1.73
  
• d2nxyc2 appears in SCOP 1.75
  
• d2nxyc2 appears in the current release, SCOPe 2.08