Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries) |
Domain d2nxyb2: 2nxy B:1098-1181 [138746] Other proteins in same PDB: d2nxya1, d2nxyb1, d2nxyc1, d2nxyc2, d2nxyd1, d2nxyd2 automatically matched to d1g9mc2 complexed with hez, nag, trs; mutant |
PDB Entry: 2nxy (more details), 2 Å
SCOP Domain Sequences for d2nxyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d2nxyb2: