SCOPe 2.08: Domain d2nxyb2: 2nxy B:1098-1181

Lineage for d2nxyb2 (2nxy B:1098-1181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)

8. Domain d2nxyb2: 2nxy B:1098-1181 [138746]
   Other proteins in same PDB: d2nxya1, d2nxyb1, d2nxyc1, d2nxyc2, d2nxyd1, d2nxyd2
   complexed with hez, nag, trs

Details for d2nxyb2

PDB Entry: 2nxy, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2nxyb2:

Sequence; same for both SEQRES and ATOM records:

>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

Timeline for d2nxyb2:

• d2nxyb2 first appeared in SCOP 1.73
  
• d2nxyb2 appears in SCOPe 2.07