| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein CD4 V-set domains [48737] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries) |
| Domain d2nxyb1: 2nxy B:1001-1097 [138745] Other proteins in same PDB: d2nxya1, d2nxyb2, d2nxyc1, d2nxyc2, d2nxyd1, d2nxyd2 complexed with hez, nag, trs |
PDB Entry: 2nxy (more details), 2 Å
SCOPe Domain Sequences for d2nxyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d2nxyb1: