Lineage for d2nxja1 (2nxj A:1-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130247Family c.66.1.39: Ribosomal protein L11 methyltransferase PrmA [102578] (1 protein)
    contains additional N-terminal ferredoxin-like domain
    automatically mapped to Pfam PF06325
  6. 2130248Protein PrmA-like protein TTHA0656 (TT0836) [102579] (1 species)
  7. 2130249Species Thermus thermophilus [TaxId:274] [102580] (8 PDB entries)
  8. 2130256Domain d2nxja1: 2nxj A:1-254 [138742]
    automatically matched to d1ufka_

Details for d2nxja1

PDB Entry: 2nxj (more details), 2.3 Å

PDB Description: T.thermophilus ribosomal protein L11 methyltransferase (PrmA) in space group P 21 21 2
PDB Compounds: (A:) Ribosomal protein L11 methyltransferase

SCOPe Domain Sequences for d2nxja1:

Sequence, based on SEQRES records: (download)

>d2nxja1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}
mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
eaaegewvllaygr

Sequence, based on observed residues (ATOM records): (download)

>d2nxja1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}
mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevedwlea
wrrdlkpalappfvvlapwhtwegaeiplviepgghhettrlalkalarhlrpgdkvldl
gtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgpfdl
lvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleeaaegew
vllaygr

SCOPe Domain Coordinates for d2nxja1:

Click to download the PDB-style file with coordinates for d2nxja1.
(The format of our PDB-style files is described here.)

Timeline for d2nxja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nxjb1