Lineage for d2nxea1 (2nxe A:1-254)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865423Family c.66.1.39: Ribosomal protein L11 methyltransferase PrmA [102578] (1 protein)
    contains additional N-terminal ferredoxin-like domain
    automatically mapped to Pfam PF06325
  6. 1865424Protein PrmA-like protein TTHA0656 (TT0836) [102579] (1 species)
  7. 1865425Species Thermus thermophilus [TaxId:274] [102580] (8 PDB entries)
  8. 1865428Domain d2nxea1: 2nxe A:1-254 [138740]
    automatically matched to d1ufka_
    complexed with sam

Details for d2nxea1

PDB Entry: 2nxe (more details), 1.75 Å

PDB Description: T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with S-Adenosyl-L-Methionine
PDB Compounds: (A:) Ribosomal protein L11 methyltransferase

SCOPe Domain Sequences for d2nxea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxea1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}
mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
eaaegewvllaygr

SCOPe Domain Coordinates for d2nxea1:

Click to download the PDB-style file with coordinates for d2nxea1.
(The format of our PDB-style files is described here.)

Timeline for d2nxea1: