SCOPe 2.08: Domain d2nxea1: 2nxe A:1-254

Lineage for d2nxea1 (2nxe A:1-254)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.39: Ribosomal protein L11 methyltransferase PrmA [102578] (1 protein)
   contains additional N-terminal ferredoxin-like domain
   automatically mapped to Pfam PF06325

6. Protein PrmA-like protein TTHA0656 (TT0836) [102579] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102580] (8 PDB entries)

8. Domain d2nxea1: 2nxe A:1-254 [138740]
   automatically matched to d1ufka_
   complexed with sam

Details for d2nxea1

PDB Entry: 2nxe, 1.75 Å

PDB Description: T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with S-Adenosyl-L-Methionine

PDB Compounds: (A:) Ribosomal protein L11 methyltransferase

SCOPe Domain Sequences for d2nxea1:

Sequence; same for both SEQRES and ATOM records:

>d2nxea1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}
mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
eaaegewvllaygr

Timeline for d2nxea1:

• d2nxea1 first appeared in SCOP 1.73
  
• d2nxea1 appears in SCOPe 2.07