| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries) |
| Domain d2nx5q2: 2nx5 Q:1-181 [138737] Other proteins in same PDB: d2nx5a1, d2nx5b_, d2nx5f1, d2nx5g_, d2nx5k1, d2nx5l_, d2nx5q1, d2nx5r_ automatically matched to d1a1ma2 |
PDB Entry: 2nx5 (more details), 2.7 Å
SCOPe Domain Sequences for d2nx5q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nx5q2 d.19.1.1 (Q:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r
Timeline for d2nx5q2: