| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
| Domain d2nx5k1: 2nx5 K:182-276 [138733] Other proteins in same PDB: d2nx5a2, d2nx5b1, d2nx5f2, d2nx5g1, d2nx5k2, d2nx5l1, d2nx5q2, d2nx5r1 automatically matched to d1a1ma1 |
PDB Entry: 2nx5 (more details), 2.7 Å
SCOP Domain Sequences for d2nx5k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nx5k1 b.1.1.2 (K:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d2nx5k1: