![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d2nx5g_: 2nx5 G: [138732] Other proteins in same PDB: d2nx5a1, d2nx5a2, d2nx5f1, d2nx5f2, d2nx5k1, d2nx5k2, d2nx5q1, d2nx5q2 automated match to d1a1mb_ |
PDB Entry: 2nx5 (more details), 2.7 Å
SCOPe Domain Sequences for d2nx5g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nx5g_ b.1.1.2 (G:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2nx5g_: