Lineage for d2nx5a2 (2nx5 A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198193Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)
  8. 1198221Domain d2nx5a2: 2nx5 A:1-181 [138728]
    Other proteins in same PDB: d2nx5a1, d2nx5b_, d2nx5f1, d2nx5g_, d2nx5k1, d2nx5l_, d2nx5q1, d2nx5r_
    automatically matched to d1a1ma2

Details for d2nx5a2

PDB Entry: 2nx5 (more details), 2.7 Å

PDB Description: crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a
PDB Compounds: (A:) hla-b35

SCOPe Domain Sequences for d2nx5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nx5a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2nx5a2:

Click to download the PDB-style file with coordinates for d2nx5a2.
(The format of our PDB-style files is described here.)

Timeline for d2nx5a2: