Lineage for d2nwxb1 (2nwx B:12-416)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633874Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
    multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer
  4. 2633875Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) (S)
    automatically mapped to Pfam PF00375
  5. 2633876Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins)
  6. 2633877Protein Proton glutamate symport protein [118217] (1 species)
  7. 2633878Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
    Uniprot O59010 # PH1295
  8. 2633883Domain d2nwxb1: 2nwx B:12-416 [138725]
    automatically matched to d1xfha_
    complexed with asp, na, plm

Details for d2nwxb1

PDB Entry: 2nwx (more details), 3.29 Å

PDB Description: crystal structure of gltph in complex with l-aspartate and sodium ions
PDB Compounds: (B:) 425aa long hypothetical proton glutamate symport protein

SCOPe Domain Sequences for d2nwxb1:

Sequence, based on SEQRES records: (download)

>d2nwxb1 f.49.1.1 (B:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakte

Sequence, based on observed residues (ATOM records): (download)

>d2nwxb1 f.49.1.1 (B:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavgpplvhilldivpt
npfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldainglaeamykivng
vmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvllkiygidpis
fikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinmdgtalyqgv
ctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvglpltdpnva
aayamilgidaildmgrtmvnvtgdltgtaivakte

SCOPe Domain Coordinates for d2nwxb1:

Click to download the PDB-style file with coordinates for d2nwxb1.
(The format of our PDB-style files is described here.)

Timeline for d2nwxb1: