SCOPe 2.07: Domain d2nwwc1: 2nww C:12-416

Lineage for d2nwwc1 (2nww C:12-416)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
   multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer

4. Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family)
   automatically mapped to Pfam PF00375

5. Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins)

6. Protein Proton glutamate symport protein [118217] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
   Uniprot O59010 # PH1295

8. Domain d2nwwc1: 2nww C:12-416 [138723]
   automatically matched to d1xfha_
   complexed with tb1

Details for d2nwwc1

PDB Entry: 2nww, 3.2 Å

PDB Description: crystal structure of gltph in complex with tboa

PDB Compounds: (C:) 425aa long hypothetical proton glutamate symport protein

SCOPe Domain Sequences for d2nwwc1:

Sequence; same for both SEQRES and ATOM records:

>d2nwwc1 f.49.1.1 (C:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakte

Timeline for d2nwwc1:

• d2nwwc1 first appeared in SCOP 1.73
  
• d2nwwc1 appears in SCOPe 2.06
  
• d2nwwc1 appears in the current release, SCOPe 2.08