Lineage for d2nwwc1 (2nww C:12-416)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1061059Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
    multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer
  4. 1061060Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) (S)
  5. 1061061Family f.49.1.1: Proton glutamate symport protein [118216] (1 protein)
  6. 1061062Protein Proton glutamate symport protein [118217] (1 species)
  7. 1061063Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
    Uniprot O59010 # PH1295
  8. 1061066Domain d2nwwc1: 2nww C:12-416 [138723]
    automatically matched to d1xfha_
    complexed with tb1

Details for d2nwwc1

PDB Entry: 2nww (more details), 3.2 Å

PDB Description: crystal structure of gltph in complex with tboa
PDB Compounds: (C:) 425aa long hypothetical proton glutamate symport protein

SCOPe Domain Sequences for d2nwwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwwc1 f.49.1.1 (C:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakte

SCOPe Domain Coordinates for d2nwwc1:

Click to download the PDB-style file with coordinates for d2nwwc1.
(The format of our PDB-style files is described here.)

Timeline for d2nwwc1: