![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.49: Proton glutamate symport protein [118214] (1 superfamily) multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer |
![]() | Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) ![]() |
![]() | Family f.49.1.1: Proton glutamate symport protein [118216] (1 protein) |
![]() | Protein Proton glutamate symport protein [118217] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries) |
![]() | Domain d2nwwc1: 2nww C:12-416 [138723] automatically matched to d1xfha_ complexed with tb1; mutant |
PDB Entry: 2nww (more details), 3.2 Å
SCOP Domain Sequences for d2nwwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nwwc1 f.49.1.1 (C:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakte
Timeline for d2nwwc1: