Lineage for d2nwwb1 (2nww B:12-416)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028642Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
    multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer
  4. 3028643Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) (S)
    automatically mapped to Pfam PF00375
  5. 3028644Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins)
  6. 3028645Protein Proton glutamate symport protein [118217] (1 species)
  7. 3028646Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
    Uniprot O59010 # PH1295
  8. 3028648Domain d2nwwb1: 2nww B:12-416 [138722]
    automatically matched to d1xfha_
    complexed with tb1

Details for d2nwwb1

PDB Entry: 2nww (more details), 3.2 Å

PDB Description: crystal structure of gltph in complex with tboa
PDB Compounds: (B:) 425aa long hypothetical proton glutamate symport protein

SCOPe Domain Sequences for d2nwwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwwb1 f.49.1.1 (B:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakte

SCOPe Domain Coordinates for d2nwwb1:

Click to download the PDB-style file with coordinates for d2nwwb1.
(The format of our PDB-style files is described here.)

Timeline for d2nwwb1: