SCOP 1.73: Domain d2nwdx1: 2nwd X:1-130

Lineage for d2nwdx1 (2nwd X:1-130)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)

8. Domain d2nwdx1: 2nwd X:1-130 [138718]
   automatically matched to d1c7pa_

Details for d2nwdx1

PDB Entry: 2nwd, 1.04 Å

PDB Description: Structure of chemically synthesized human lysozyme at 1 Angstrom resolution

PDB Compounds: (X:) Lysozyme C

SCOP Domain Sequences for d2nwdx1:

Sequence; same for both SEQRES and ATOM records:

>d2nwdx1 d.2.1.2 (X:1-130) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d2nwdx1:

• d2nwdx1 is new in SCOP 1.73
  
• d2nwdx1 appears in SCOP 1.75
  
• d2nwdx1 appears in the current release, SCOPe 2.08