Lineage for d2nw9b_ (2nw9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016335Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2016336Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2016374Family a.266.1.0: automated matches [227197] (1 protein)
    not a true family
  6. 2016375Protein automated matches [226924] (2 species)
    not a true protein
  7. 2016393Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries)
  8. 2016397Domain d2nw9b_: 2nw9 B: [138717]
    automated match to d3e08a_
    complexed with ft6, hem, mn

Details for d2nw9b_

PDB Entry: 2nw9 (more details), 1.8 Å

PDB Description: Crystal Structure of Tryptophan 2,3-dioxygenase (TDO) from Xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. Northeast Structural Genomics Target XcR13
PDB Compounds: (B:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d2nw9b_:

Sequence, based on SEQRES records: (download)

>d2nw9b_ a.266.1.0 (B:) automated matches {Xanthomonas campestris [TaxId: 340]}
dlegrltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhl
qrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryief
llgnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaah
vaddtlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtgg
ssgvgflqqalaltffpelfdvrtsvgvdnrppqg

Sequence, based on observed residues (ATOM records): (download)

>d2nw9b_ a.266.1.0 (B:) automated matches {Xanthomonas campestris [TaxId: 340]}
dlegrltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhl
qrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryief
llgnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaah
vaddtlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfssgvgf
lqqalaltffpelfdvrtsvgvdnrppqg

SCOPe Domain Coordinates for d2nw9b_:

Click to download the PDB-style file with coordinates for d2nw9b_.
(The format of our PDB-style files is described here.)

Timeline for d2nw9b_: