Lineage for d2nw9a1 (2nw9 A:23-284)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781101Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 781102Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (2 families) (S)
    contains heme-dependent enzymes
  5. 781103Family a.266.1.1: Bacterial tryptophan 2,3-dioxygenase [140960] (1 protein)
    Pfam PF03301
  6. 781104Protein Tryptophan 2,3-dioxygenase [140961] (1 species)
  7. 781105Species Xanthomonas campestris pv. campestris [TaxId:340] [140962] (4 PDB entries)
    Uniprot Q8PDA8 23-284
  8. 781108Domain d2nw9a1: 2nw9 A:23-284 [138716]
    automatically matched to 1YW0 A:23-284
    complexed with ft6, hem, mn

Details for d2nw9a1

PDB Entry: 2nw9 (more details), 1.8 Å

PDB Description: Crystal Structure of Tryptophan 2,3-dioxygenase (TDO) from Xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. Northeast Structural Genomics Target XcR13
PDB Compounds: (A:) Tryptophan 2,3-dioxygenase

SCOP Domain Sequences for d2nw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nw9a1 a.266.1.1 (A:23-284) Tryptophan 2,3-dioxygenase {Xanthomonas campestris pv. campestris [TaxId: 340]}
tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
lqqalaltffpelfdvrtsvgv

SCOP Domain Coordinates for d2nw9a1:

Click to download the PDB-style file with coordinates for d2nw9a1.
(The format of our PDB-style files is described here.)

Timeline for d2nw9a1: