SCOPe 2.06: Domain d2nw8a_: 2nw8 A:

Lineage for d2nw8a_ (2nw8 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
   multihelical; bundle, contains interrupted helices

4. Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families)
   contains heme-dependent enzymes

5. Family a.266.1.0: automated matches [227197] (1 protein)
   not a true family

6. Protein automated matches [226924] (2 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries)

8. Domain d2nw8a_: 2nw8 A: [138714]
   automated match to d3e08a_
   complexed with hem, mn, trp

Details for d2nw8a_

PDB Entry: 2nw8, 1.6 Å

PDB Description: Crystal Structure of Tryptophan 2,3-dioxygenase (TDO) from Xanthomonas campestris in complex with ferrous heme and tryptophan. Northeast Structural Genomics Target XcR13.

PDB Compounds: (A:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d2nw8a_:

Sequence; same for both SEQRES and ATOM records:

>d2nw8a_ a.266.1.0 (A:) automated matches {Xanthomonas campestris [TaxId: 340]}
egrltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqr
devwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefll
gnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahva
ddtlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggss
gvgflqqalaltffpelfdvrtsvgv

Timeline for d2nw8a_:

• d2nw8a_ first appeared in SCOP 1.73, called d2nw8a1
  
• d2nw8a_ appears in SCOPe 2.05
  
• d2nw8a_ appears in SCOPe 2.07
  
• d2nw8a_ appears in the current release, SCOPe 2.08