Lineage for d2nw8a1 (2nw8 A:23-284)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651899Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 651900Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (2 families) (S)
    contains heme-dependent enzymes
  5. 651901Family a.266.1.1: Bacterial tryptophan 2,3-dioxygenase [140960] (1 protein)
    Pfam PF03301
  6. 651902Protein Tryptophan 2,3-dioxygenase [140961] (1 species)
  7. 651903Species Xanthomonas campestris pv. campestris [TaxId:340] [140962] (4 PDB entries)
  8. 651904Domain d2nw8a1: 2nw8 A:23-284 [138714]
    automatically matched to 1YW0 A:23-284
    complexed with hem, mn, trp

Details for d2nw8a1

PDB Entry: 2nw8 (more details), 1.6 Å

PDB Description: Crystal Structure of Tryptophan 2,3-dioxygenase (TDO) from Xanthomonas campestris in complex with ferrous heme and tryptophan. Northeast Structural Genomics Target XcR13.
PDB Compounds: (A:) Tryptophan 2,3-dioxygenase

SCOP Domain Sequences for d2nw8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nw8a1 a.266.1.1 (A:23-284) Tryptophan 2,3-dioxygenase {Xanthomonas campestris pv. campestris [TaxId: 340]}
tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
lqqalaltffpelfdvrtsvgv

SCOP Domain Coordinates for d2nw8a1:

Click to download the PDB-style file with coordinates for d2nw8a1.
(The format of our PDB-style files is described here.)

Timeline for d2nw8a1: