![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily) multihelical; bundle, contains interrupted helices |
![]() | Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) ![]() contains heme-dependent enzymes |
![]() | Family a.266.1.0: automated matches [227197] (1 protein) not a true family |
![]() | Protein automated matches [226924] (2 species) not a true protein |
![]() | Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries) |
![]() | Domain d2nw7b_: 2nw7 B: [138711] automated match to d3e08a_ complexed with hem |
PDB Entry: 2nw7 (more details), 2.7 Å
SCOPe Domain Sequences for d2nw7b_:
Sequence, based on SEQRES records: (download)
>d2nw7b_ a.266.1.0 (B:) automated matches {Xanthomonas campestris [TaxId: 340]} rltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrde vwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgn knpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvadd tlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgv gflqqalaltffpelfdvrtsvgv
>d2nw7b_ a.266.1.0 (B:) automated matches {Xanthomonas campestris [TaxId: 340]} rltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrde vwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgn knpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvadd tlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkssgvgflqq alaltffpelfdvrtsvgv
Timeline for d2nw7b_: