Lineage for d2nvzj1 (2nvz J:1-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309044Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2309045Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2309046Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 2309047Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 2309077Domain d2nvzj1: 2nvz J:1-65 [138703]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzk1, d2nvzl1
    automatically matched to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvzj1

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2nvzj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvzj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2nvzj1:

Click to download the PDB-style file with coordinates for d2nvzj1.
(The format of our PDB-style files is described here.)

Timeline for d2nvzj1: