![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
![]() | Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) |
![]() | Domain d2nvzi2: 2nvz I:50-120 [138702] Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzj1, d2nvzk1, d2nvzl1 automatically matched to d1i3qi2 complexed with mg, utp, zn |
PDB Entry: 2nvz (more details), 4.3 Å
SCOP Domain Sequences for d2nvzi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvzi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtq
Timeline for d2nvzi2: