| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.2: RPB6 [55294] (1 protein) |
| Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries) Uniprot P20435; part of multichain biological unit |
| Domain d2nvzf1: 2nvz F:72-154 [138699] Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1 automatically matched to d1i3qf_ protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2nvz (more details), 4.3 Å
SCOPe Domain Sequences for d2nvzf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvzf1 a.143.1.2 (F:72-154) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd
Timeline for d2nvzf1: