Lineage for d2nvze2 (2nvz E:144-215)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565294Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2565295Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2565296Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2565297Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2565298Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2565326Domain d2nvze2: 2nvz E:144-215 [138698]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvze2

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvze2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2nvze2:

Click to download the PDB-style file with coordinates for d2nvze2.
(The format of our PDB-style files is described here.)

Timeline for d2nvze2: