SCOPe 2.05: Domain d2nvzc2: 2nvz C:42-172

Lineage for d2nvzc2 (2nvz C:42-172)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2nvzc2: 2nvz C:42-172 [138696]
   Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
   automatically matched to d1i3qc2
   protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvzc2

PDB Entry: 2nvz, 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2nvzc2:

Sequence; same for both SEQRES and ATOM records:

>d2nvzc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d2nvzc2:

• d2nvzc2 first appeared in SCOP 1.73
  
• d2nvzc2 appears in SCOPe 2.04
  
• d2nvzc2 appears in SCOPe 2.06
  
• d2nvzc2 appears in the current release, SCOPe 2.08