Lineage for d2nvzc2 (2nvz C:42-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739032Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 739033Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 739034Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 739087Protein RPB3 [64462] (1 species)
  7. 739088Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
  8. 739113Domain d2nvzc2: 2nvz C:42-172 [138696]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1i3qc2
    complexed with mg, utp, zn

Details for d2nvzc2

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOP Domain Sequences for d2nvzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvzc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOP Domain Coordinates for d2nvzc2:

Click to download the PDB-style file with coordinates for d2nvzc2.
(The format of our PDB-style files is described here.)

Timeline for d2nvzc2: