Lineage for d2nvza1 (2nvz A:2-1445)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694889Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 1694890Protein RBP1 [64486] (2 species)
  7. 1694891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 1694915Domain d2nvza1: 2nvz A:2-1445 [138693]
    Other proteins in same PDB: d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1i50a_
    protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvza1

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: RNA Polymerase II elongation complex with UTP, updated 11/2006
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2nvza1:

Sequence, based on SEQRES records: (download)

>d2nvza1 e.29.1.2 (A:2-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmi

Sequence, based on observed residues (ATOM records): (download)

>d2nvza1 e.29.1.2 (A:2-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpselvsrggcgntqptirkdglklvgswl
rvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpsisfnesqrge
ddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqagrpvk
sirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevvtpy
nidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdndpvl
fnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetraelsq
lcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgviptp
aiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekktvg
ssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreiteti
aeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdlnnv
kqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfvens
ylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnslgnv
iqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseilgdl
klqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsdlti
kdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkqafd
wvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfhfagvaskkvtsgvprlke
ilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdprstvi
pedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviwsedli
ircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvle
tdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasdgsyvnyrh
mallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsen
vilgqmapigtgafdvmi

SCOPe Domain Coordinates for d2nvza1:

Click to download the PDB-style file with coordinates for d2nvza1.
(The format of our PDB-style files is described here.)

Timeline for d2nvza1: