Lineage for d2nvyi1 (2nvy I:2-49)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2262985Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 2262986Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)
  6. 2262987Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 2262988Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 2263009Domain d2nvyi1: 2nvy I:2-49 [138688]
    Other proteins in same PDB: d2nvya1, d2nvyb1, d2nvyc1, d2nvyc2, d2nvye1, d2nvye2, d2nvyf1, d2nvyh1, d2nvyj1, d2nvyk1, d2nvyl1
    automatically matched to d1i3qi1
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d2nvyi1

PDB Entry: 2nvy (more details), 3.4 Å

PDB Description: RNA Polymerase II form II in 150 mM Mn+2
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2nvyi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvyi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d2nvyi1:

Click to download the PDB-style file with coordinates for d2nvyi1.
(The format of our PDB-style files is described here.)

Timeline for d2nvyi1: